PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G022150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 241aa    MW: 26042.7 Da    PI: 6.9567
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G022150.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.4e-42871861100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l+++pe++r+da+ss+vyeA+ar+rdPvyG++g i +lq+q+++
  HL.SW.v1.0.G022150.1  87 PCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHRVFGASNIIKFLQEIPESQRTDAVSSMVYEANARIRDPVYGCAGAICQLQKQVSE 175
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ +la++++e
  HL.SW.v1.0.G022150.1 176 LQGQLAKAQAE 186
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.89886187IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4287184IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEFKPKAQTP PRLTVPTPFS LSVPLQYSPN NSSSSSPTLN SSQLSSPASS FPSPSPPTSQ  60
SSPTSTTNVN PTPPPPPPPP PAIVMSPCAA CKILRRRCVD KCVLAPYFPP TEPLKFTIAH  120
RVFGASNIIK FLQEIPESQR TDAVSSMVYE ANARIRDPVY GCAGAICQLQ KQVSELQGQL  180
AKAQAELVNM QCQQANLIAL ICMDVTQLQD PNSQQQPPYV DTSCFLDDNT LGTTWEPLWT  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108453.11e-115hypothetical protein L484_014124
SwissprotQ9LQR06e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RZL71e-115W9RZL7_9R
STRINGPOPTR_0008s04350.18e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-74LOB domain-containing protein 1